- Longevity Research
FOXO4-DRI 10mg
Free Shipping on Orders Over $150!
$201.50
In stock
Chemical Information:
Molecular Formula: C228H388N86O64
Molecular Weight: 5358.05 Da
Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-retro-inverso; all D-amino acids)
Molecular Structure: Refer to Certificate of Analysis for detailed structural information.
Storage and Handling:
Store sealed at recommended laboratory freezer temperatures.
Protect from light, moisture, and excessive heat.
Handle using standard laboratory safety procedures to maintain product integrity.
Product Specifications:
Purity: ≥99% (HPLC Verified)
Appearance: White to off-white lyophilized powder
Solubility: Refer to Certificate of Analysis for physicochemical properties
Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.





