Showing 1–15 of 18 results
-
$65.50
5-Amino-1MQ Chemical Information: Molecular Formula: C₇H₁₁N₅ Molecular Weight: 165.20 g/mol Chemical Name: 5-Amino-1-methylquinolin-1-ium Description: 5-Amino-1MQ is a small-molecule experimental compound that functions as a methyltransferase inhibitor, particularly targeting nicotinamide N-methyltransferase (NNMT). This enzyme plays a role in regulating cellular energy metabolism, making 5-Amino-1MQ a focus of research into obesity, metabolic disorders, and age-related energy decline….
-
$230.00
Chemical Information: Molecular Formula: C10H11N2+ (as iodide salt: C10H11N2·I) Molecular Weight: 159.21 g/mol (286.11 g/mol as iodide salt) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle…
-
$92.00
Product Contains (per mL): L-Carnitine: 200 mg Arginine: 20 mg Methionine: 25 mg Inositol: 50 mg Choline: 50 mg Vitamin B5 (Dexpanthenol): 25 mg Vitamin B6 (Pyridoxine): 25 mg Vitamin B12 (Methylcobalamin): 400 mcg Storage: Store refrigerated at 2-8°C. Protect from direct exposure to light and heat. Product Specifications: Appearance: Red solution Solubility: Fully soluble…
-
$230.00
Chemical Information: Molecular Formula: C16H10F2N6O Molecular Weight: 340.29 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….
-
$114.00
Product Name:Epithalon (Epitalon / Epithalamin Analog) Chemical Information: Molecular Formula: C₁₄H₂₂N₄O₉ Molecular Weight: 390.35 g/mol Sequence: Ala-Glu-Asp-Gly Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Epithalon (also known as Epitalon or Epithalamin Analog) is a synthetic tetrapeptide extensively studied for its potential role in cellular aging and telomere biology. Originally derived from…
-
$201.50
Chemical Information: Molecular Formula: C228H388N86O64 Molecular Weight: 5358.05 Da Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-retro-inverso; all D-amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications:…
-
$41.50 – $57.00Price range: $41.50 through $57.00
Chemical Information: Molecular Formula: C₁₄H₂₄N₆O₄Cu Molecular Weight: 340.84 g/mol Sequence: Gly-His-Lys Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…
-
$114.00
All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.
-
$78.00
Chemical Information: Molecular Formula: C₁₀H₁₇N₃O₆S Molecular Weight: 307.32 g/mol Sequence: γ-L-Glutamyl-L-cysteinylglycine Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Glutathione is a naturally occurring tripeptide composed of the amino acids glutamine, cysteine, and glycine. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle…
-
$137.00
All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.
-
$43.50
Product Name:KPV (Lys-Pro-Val) Chemical Information: Molecular Formula: C₁₇H₂₈N₄O₅ Molecular Weight: 384.43 g/mol Sequence: Lys-Pro-Val Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
-
$69.00
Chemical Information: Molecular Formula: C₇H₁₅NO₃ Molecular Weight: 161.20 g/mol Chemical Name: (R)-3-Hydroxy-4-(trimethylammonio)butanoate Description:L-Carnitine is a water-soluble quaternary ammonium compound naturally derived from lysine and methionine. This liquid formulation provides a highly concentration of L-Carnitine at 500 mg/mL, offering ease of use and consistent measurement for research applications. L-Carnitine plays a crucial role in mitochondrial energy…
-
$45.00 – $148.50Price range: $45.00 through $148.50
Chemical Information: Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂ Molecular Weight: 2174.63 g/mol Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…
-
$76.00 – $108.00Price range: $76.00 through $108.00
Chemical Information: Molecular Formula: C₂₁H₂₇N₇O₁₄P₂ Molecular Weight: 663.43 g/mol Sequence: N/A (NAD+ is a small molecule, not a peptide) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…
-
$161.00
Chemical Information: Molecular Formula: C18H14N2O2 Molecular Weight: 290.32 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….
