Category

Defense Peptide Research

1 compound · all third-party tested

Ships same day Monday–Friday*

*Orders placed before 12 PM PST

  • LL-37 10mg

    LL-37 10mg

    $60.00

    Chemical Information: Molecular Formula: C205H340N60O53 Molecular Weight: 4493.37 Da Sequence: [LL-37, 37 aa] (37 amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 60 points!Add to cartDone

Oasis Labs

Where Science Meets Serenity.

Oasis Labs is a chemical supplier offering products strictly for research, laboratory, analytical, and development purposes only. All products sold on this website are not for human consumption of any kind and are not intended for medical, therapeutic, or diagnostic use. Our products must not be misconstrued as, or substituted for, prescription medications. Oasis Labs is not a compounding pharmacy or chemical compounding facility as defined under Section 503A of the Federal Food, Drug, and Cosmetic Act, nor is it an outsourcing facility as defined under Section 503B of the Federal Food, Drug, and Cosmetic Act. The statements made on this website have not been evaluated by the U.S. Food and Drug Administration. The products and statements on this site are not intended to diagnose, treat, cure, or prevent any disease or medical condition. Oasis Labs guarantees 99% purity for all research peptides based on industry-standard testing methods. Due to standard analytical variability, actual purity may fall within an acceptable standard deviation of up to ±2% of the stated value. By purchasing from Oasis Labs, customers acknowledge and agree that all products are intended solely for legitimate research, laboratory, or analytical purposes.

© 2026 Oasis Labs · All Rights Reserved

Privacy Terms Returns