Free shipping on orders $150+Orders before 12pm PST ship same day (M–F) * terms applyAll products sold are for research use only, not for human consumption99%+ purity · Independently lab tested · Made in the USA
Free shipping on orders $150+ Orders before 12pm PST ship same day (M-F) * Terms apply All products sold are for research use only, not for human consumption

LL-37 10mg

  • LL-37 10mg

    LL-37 10mg

    $60.00

    Chemical Information: Molecular Formula: C205H340N60O53 Molecular Weight: 4493.37 Da Sequence: [LL-37, 37 aa] (37 amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…

    Purchase & earn 60 points!Add to cartLoading Done