-
$75.00
Chemical Information: Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅ Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…
-
Sale!
$48.00 – $368.00Price range: $48.00 through $368.00
Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…
-
$207.00
Chemical Information: Molecular Formula: C48H48F2N10O5 Molecular Weight: 882.97 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….
