Showing 1–15 of 52 results
-
$65.50
5-Amino-1MQ Chemical Information: Molecular Formula: C₇H₁₁N₅ Molecular Weight: 165.20 g/mol Chemical Name: 5-Amino-1-methylquinolin-1-ium Description: 5-Amino-1MQ is a small-molecule experimental compound that functions as a methyltransferase inhibitor, particularly targeting nicotinamide N-methyltransferase (NNMT). This enzyme plays a role in regulating cellular energy metabolism, making 5-Amino-1MQ a focus of research into obesity, metabolic disorders, and age-related energy decline….
-
$230.00
Chemical Information: Molecular Formula: C10H11N2+ (as iodide salt: C10H11N2·I) Molecular Weight: 159.21 g/mol (286.11 g/mol as iodide salt) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle…
-
$14.00
Acetic Acid 0.6% Solution is a sterile, non-pyrogenic solution specifically prepared for laboratory research applications. It serves primarily as a reconstitution solvent or diluent for compatible peptides or other laboratory substances in controlled experimental conditions. Product Characteristics: Volume: 10mL Composition: Sterile water containing 0.6% acetic acid Purpose: Solvent/diluent for peptide reconstitution and laboratory research Multi-use…
-
$50.50
All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.
-
$92.00
Product Contains (per mL): L-Carnitine: 200 mg Arginine: 20 mg Methionine: 25 mg Inositol: 50 mg Choline: 50 mg Vitamin B5 (Dexpanthenol): 25 mg Vitamin B6 (Pyridoxine): 25 mg Vitamin B12 (Methylcobalamin): 400 mcg Storage: Store refrigerated at 2-8°C. Protect from direct exposure to light and heat. Product Specifications: Appearance: Red solution Solubility: Fully soluble…
-
$9.00
Bacteriostatic Water 0.9% is a sterile, non-pyrogenic solution containing 0.9% benzyl alcohol as a preservative. It is specifically prepared for laboratory research applications, intended primarily as a solvent or diluent for peptide reconstitution and other compatible substances in controlled experimental settings. The benzyl alcohol present helps inhibit bacterial growth, facilitating multiple withdrawals under aseptic conditions….
-
$22.50
BAC Water 0.9% is a solution containing 0.9% benzyl alcohol as a preservative. It is specifically prepared for laboratory research applications, intended primarily as a solvent or diluent in controlled experimental settings. The benzyl alcohol present helps inhibit bacterial growth, facilitating multiple withdrawals under aseptic conditions. Product Characteristics: Volume: 30mL Composition: Sterile water containing 0.9%…
-
$230.00
Chemical Information: Molecular Formula: C16H10F2N6O Molecular Weight: 340.29 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….
-
$28.00 – $48.50Price range: $28.00 through $48.50
Chemical Information: Molecular Formula: C₆₂H₉₈N₁₆O₂₂ Molecular Weight: 1419.54 g/mol Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of…
-
$138.00
Chemical Information: Molecular Formula: C₆₂H₉₈N₁₆O₂₂ Molecular Weight: 1419.54 g/mol Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain…
-
$61.00 – $102.50Price range: $61.00 through $102.50
Chemical Information: BPC-157 Molecular Formula: C₆₂H₉₈N₁₆O₂₂ BPC-157 Molecular Weight: 1419.54 g/mol BPC-157 Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val TB-500 Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S TB-500 Molecular Weight: 4963.44 g/mol TB-500 Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Ala-Gln-Gly-Gln-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle…
-
$75.00
Chemical Information: Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅ Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…
-
$98.00
Chemical Information: Molecular Formula: Complex mixture of low molecular weight peptides and free amino acids Molecular Weight: Mixture (25% peptides including BDNF, GDNF, NGF, CNTF; 75% free amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and…
-
$78.00
Chemical Information: Molecular Formula: C₁₆₅H₂₆₉N₄₇O₄₆ Molecular Weight: 3647.2 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Leu-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…
-
$39.00
Chemical Information: Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂ Molecular Weight: 3367.99 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Asp-Ile-Met-Ser-Arg-Lys-Lys-Gln-Gln-Phe-Gln-Gly-Leu-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:CJC-1295 no DAC is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). In laboratory research, it has been studied for its potential to stimulate endogenous growth hormone (GH) secretion from the anterior…
