Catalog

Shop

54 compounds · all third-party tested

Ships same day Monday–Friday*

*Orders placed before 12 PM PST

  • 5-Amino-1MQ 10mg

    5-Amino-1MQ 10mg

    $65.50

    5-Amino-1MQ Chemical Information: Molecular Formula: C₇H₁₁N₅ Molecular Weight: 165.20 g/mol Chemical Name: 5-Amino-1-methylquinolin-1-ium Description: 5-Amino-1MQ is a small-molecule experimental compound that functions as a methyltransferase inhibitor, particularly targeting nicotinamide N-methyltransferase (NNMT). This enzyme plays a role in regulating cellular energy metabolism, making 5-Amino-1MQ a focus of research into obesity, metabolic disorders, and age-related energy decline….

    Purchase & earn 66 points!Add to cartDone
  • 5-Amino-1MQ 50mg Capsules (60ct)

    5-Amino-1MQ 50mg Capsules (60ct)

    $230.00

    Chemical Information: Molecular Formula: C10H11N2+ (as iodide salt: C10H11N2·I) Molecular Weight: 159.21 g/mol (286.11 g/mol as iodide salt) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle…

    Purchase & earn 230 points!Add to cartDone
  • Acetic Acid 0.6% 10ml

    Acetic Acid 0.6% 10ml

    $14.00

    Acetic Acid 0.6% Solution is a sterile, non-pyrogenic solution specifically prepared for laboratory research applications. It serves primarily as a reconstitution solvent or diluent for compatible peptides or other laboratory substances in controlled experimental conditions. Product Characteristics: Volume: 10mL Composition: Sterile water containing 0.6% acetic acid Purpose: Solvent/diluent for peptide reconstitution and laboratory research Multi-use…

    Purchase & earn 14 points!Add to cartDone
  • AOD-9604 5mg

    AOD-9604 5mg

    $50.50

    All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

    Purchase & earn 51 points!Add to cartDone
  • B12 MIC Complex 10ml

    B12 MIC Complex 10ml

    $92.00

    Product Contains (per mL): L-Carnitine: 200 mg Arginine: 20 mg Methionine: 25 mg Inositol: 50 mg Choline: 50 mg Vitamin B5 (Dexpanthenol): 25 mg Vitamin B6 (Pyridoxine): 25 mg Vitamin B12 (Methylcobalamin): 400 mcg Storage: Store refrigerated at 2-8°C. Protect from direct exposure to light and heat. Product Specifications: Appearance: Red solution Solubility: Fully soluble…

    Purchase & earn 92 points!Add to cartDone
  • BAC Water 10ml

    BAC Water 10ml

    $9.00

    Bacteriostatic Water 0.9% is a sterile, non-pyrogenic solution containing 0.9% benzyl alcohol as a preservative. It is specifically prepared for laboratory research applications, intended primarily as a solvent or diluent for peptide reconstitution and other compatible substances in controlled experimental settings. The benzyl alcohol present helps inhibit bacterial growth, facilitating multiple withdrawals under aseptic conditions….

    Purchase & earn 9 points!Add to cartDone
  • BAC Water 30ml

    BAC Water 30ml

    $22.50

    BAC Water 0.9% is a solution containing 0.9% benzyl alcohol as a preservative. It is specifically prepared for laboratory research applications, intended primarily as a solvent or diluent in controlled experimental settings. The benzyl alcohol present helps inhibit bacterial growth, facilitating multiple withdrawals under aseptic conditions. Product Characteristics: Volume: 30mL Composition: Sterile water containing 0.9%…

    Purchase & earn 23 points!Add to cartDone
  • BAM-15 50mg Capsules (60ct)

    BAM-15 50mg Capsules (60ct)

    $230.00

    Chemical Information: Molecular Formula: C16H10F2N6O Molecular Weight: 340.29 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….

    Purchase & earn 230 points!Add to cartDone
  • BPC-157

    BPC-157

    Price range: $28.00 through $48.50

    Chemical Information: Molecular Formula: C₆₂H₉₈N₁₆O₂₂ Molecular Weight: 1419.54 g/mol Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of…

    Earn up to 49 points.Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • BPC-157 500mcg Capsules (60ct)

    BPC-157 500mcg Capsules (60ct)

    $138.00

    Chemical Information: Molecular Formula: C₆₂H₉₈N₁₆O₂₂ Molecular Weight: 1419.54 g/mol Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain…

    Purchase & earn 138 points!Add to cartDone
  • BPC-157/TB-500 Blend

    BPC-157/TB-500 Blend

    Price range: $61.00 through $102.50

    Chemical Information: BPC-157 Molecular Formula: C₆₂H₉₈N₁₆O₂₂ BPC-157 Molecular Weight: 1419.54 g/mol BPC-157 Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val TB-500 Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S TB-500 Molecular Weight: 4963.44 g/mol TB-500 Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Ala-Gln-Gly-Gln-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle…

    Earn up to 103 points.Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Cagrilintide 5mg

    Cagrilintide 5mg

    $75.00

    Chemical Information: Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅ Molecular Weight: 3946.32 g/mol Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…

    Purchase & earn 75 points!Add to cartDone
  • Cerebrolysin 60mg

    Cerebrolysin 60mg

    $98.00

    Chemical Information: Molecular Formula: Complex mixture of low molecular weight peptides and free amino acids Molecular Weight: Mixture (25% peptides including BDNF, GDNF, NGF, CNTF; 75% free amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and…

    Purchase & earn 98 points!Add to cartDone
  • CJC-1295 DAC 5mg

    CJC-1295 DAC 5mg

    $78.00

    Chemical Information: Molecular Formula: C₁₆₅H₂₆₉N₄₇O₄₆ Molecular Weight: 3647.2 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Leu-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

    Purchase & earn 78 points!Add to cartDone
  • CJC-1295 no DAC 5mg (Mod GRF 1-29)

    CJC-1295 no DAC 5mg (Mod GRF 1-29)

    $39.00

    Chemical Information: Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂ Molecular Weight: 3367.99 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Asp-Ile-Met-Ser-Arg-Lys-Lys-Gln-Gln-Phe-Gln-Gly-Leu-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:CJC-1295 no DAC is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). In laboratory research, it has been studied for its potential to stimulate endogenous growth hormone (GH) secretion from the anterior…

    Purchase & earn 39 points!Add to cartDone

Oasis Labs

Where Science Meets Serenity.

Oasis Labs is a chemical supplier offering products strictly for research, laboratory, analytical, and development purposes only. All products sold on this website are not for human consumption of any kind and are not intended for medical, therapeutic, or diagnostic use. Our products must not be misconstrued as, or substituted for, prescription medications. Oasis Labs is not a compounding pharmacy or chemical compounding facility as defined under Section 503A of the Federal Food, Drug, and Cosmetic Act, nor is it an outsourcing facility as defined under Section 503B of the Federal Food, Drug, and Cosmetic Act. The statements made on this website have not been evaluated by the U.S. Food and Drug Administration. The products and statements on this site are not intended to diagnose, treat, cure, or prevent any disease or medical condition. Oasis Labs guarantees 99% purity for all research peptides based on industry-standard testing methods. Due to standard analytical variability, actual purity may fall within an acceptable standard deviation of up to ±2% of the stated value. By purchasing from Oasis Labs, customers acknowledge and agree that all products are intended solely for legitimate research, laboratory, or analytical purposes.

© 2026 Oasis Labs · All Rights Reserved

Privacy Terms Returns