KLOW 80mg GHK-CU/BPC-157/TB-500/KPV 50/10/10/10mg Blend
$137.00All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.
Showing 31–45 of 52 results
-
-
KPV 10mg
$43.50Product Name:KPV (Lys-Pro-Val) Chemical Information: Molecular Formula: C₁₇H₂₈N₄O₅ Molecular Weight: 384.43 g/mol Sequence: Lys-Pro-Val Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
-
L-Carnitine 500mg/ml 10ml Vial
$69.00Chemical Information: Molecular Formula: C₇H₁₅NO₃ Molecular Weight: 161.20 g/mol Chemical Name: (R)-3-Hydroxy-4-(trimethylammonio)butanoate Description:L-Carnitine is a water-soluble quaternary ammonium compound naturally derived from lysine and methionine. This liquid formulation provides a highly concentration of L-Carnitine at 500 mg/mL, offering ease of use and consistent measurement for research applications. L-Carnitine plays a crucial role in mitochondrial energy…
-
LL-37 10mg
$60.00Chemical Information: Molecular Formula: C205H340N60O53 Molecular Weight: 4493.37 Da Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (37 amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity:…
-
MOTS-C
Price range: $45.00 through $148.50Chemical Information: Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂ Molecular Weight: 2174.63 g/mol Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…
Select options This product has multiple variants. The options may be chosen on the product page -
MT-2 10mg
$32.00Chemical Information: Molecular Formula: C₅₀H₆₉N₁₅O₉ Molecular Weight: 1024.18 g/mol Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…
-
NAD+
Price range: $76.00 through $108.00Chemical Information: Molecular Formula: C₂₁H₂₇N₇O₁₄P₂ Molecular Weight: 663.43 g/mol Sequence: N/A (NAD+ is a small molecule, not a peptide) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain…
Select options This product has multiple variants. The options may be chosen on the product page -
Orforglipron 6mg Capsules (60ct)
$207.00Chemical Information: Molecular Formula: C48H48F2N10O5 Molecular Weight: 882.97 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….
-
Oxytocin 10mg
$52.00Chemical Information: Molecular Formula: C43H66N12O12S2 Molecular Weight: 1007.19 Da Sequence: Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 (cyclic; disulfide bridge between Cys1-Cys6) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product…
-
PT-141 10mg
$33.50All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.
-
Selank / Semax 10/10mg Blend
$89.50Product Name:Selank / Semax Blend Chemical Information: Selank Molecular Formula: C₃₃H₅₇N₁₁O₉ Selank Molecular Weight: 751.9 g/mol Selank Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro Semax Molecular Formula: C₃₇H₅₁N₉O₁₀S Semax Molecular Weight: 813.93 g/mol Semax Sequence: Met-Glu-His-Phe-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light,…
-
Selank 10mg
$48.50Selank (Synthetic Heptapeptide Anxiolytic) Chemical Information: Molecular Formula: C₃₃H₅₇N₁₁O₉ Molecular Weight: 751.88 g/mol Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Selank is a synthetic heptapeptide developed as an analog of the naturally occurring tuftsin tetrapeptide. It has been widely researched for its potential anxiolytic, nootropic, and immunomodulatory properties. Selank…
-
Semax 10mg
$45.00Semax (ACTH-Derived Neuropeptide) Chemical Information: Molecular Formula: C₃₇H₅₁N₉O₁₀S Molecular Weight: 813.93 g/mol Sequence: Met-Glu-His-Phe-Pro-Gly-Pro Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Semax is a synthetic peptide derived from a fragment of the adrenocorticotropic hormone (ACTH). Known for its potent neuromodulatory and neuroprotective effects, Semax has garnered significant interest in scientific research…
-
Sermorlin 5mg
$55.00Chemical Information: Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S Molecular Weight: 3357.88 g/mol Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Sermorlin is a synthetic peptide analog of human growth hormone-releasing hormone (GHRH). Extensively studied for its potential role in stimulating endogenous secretion of growth hormone (GH), Sermorlin is frequently utilized in research involving…
-
SLU-PP-332 1000mcg Capsules (60ct)
$161.00Chemical Information: Molecular Formula: C18H14N2O2 Molecular Weight: 290.32 g/mol Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain product integrity….