CJC/IPA Blend 5/5mg
$76.00All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.
Showing 16–30 of 52 results

All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

Chemical Information: Molecular Formula: C27H44N4O5 Molecular Weight: 504.66 g/mol Sequence: Hexanoyl-Tyr-Ile-Ahx-NH2 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store tablets or capsules at controlled room temperature (15-25°C) in a dry, dark environment. Protect from moisture and direct exposure to sunlight. Handle according to standard laboratory protocols to maintain…

Chemical Information: Molecular Formula: C₃₅H₄₈N₁₀O₁₅ Molecular Weight: 849.8 g/mol Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

Product Name:Epithalon (Epitalon / Epithalamin Analog) Chemical Information: Molecular Formula: C₁₄H₂₂N₄O₉ Molecular Weight: 390.35 g/mol Sequence: Ala-Glu-Asp-Gly Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Epithalon (also known as Epitalon or Epithalamin Analog) is a synthetic tetrapeptide extensively studied for its potential role in cellular aging and telomere biology. Originally derived from…

Chemical Information: Molecular Formula: C228H388N86O64 Molecular Weight: 5358.05 Da Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-retro-inverso; all D-amino acids) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications:…

Chemical Information: Molecular Formula: C₁₄H₂₄N₆O₄Cu Molecular Weight: 340.84 g/mol Sequence: Gly-His-Lys Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

Chemical Information: Molecular Formula: C45H55N9O6 Molecular Weight: 817.97 Da Sequence: D-Ala-D-2Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

Chemical Information: Molecular Formula: C46H56N12O6 Molecular Weight: 873.01 Da Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

All Oasis Labs products are third-party tested by clinical labs to ensure maximum purity.

Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified) Appearance: White to off-white lyophilized powder Solubility: Refer to Certificate of Analysis for physicochemical properties Important Note:This product is strictly FOR…

Chemical Information: Molecular Formula: C₁₀H₁₇N₃O₆S Molecular Weight: 307.32 g/mol Sequence: γ-L-Glutamyl-L-cysteinylglycine Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:Glutathione is a naturally occurring tripeptide composed of the amino acids glutamine, cysteine, and glycine. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle…

Chemical Information: Molecular Formula: C55H75N17O13 Molecular Weight: 1182.31 Da Sequence: pyroGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 (decapeptide) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC…

Chemical Information: Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ Molecular Weight: 9117.53 g/mol Sequence: MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIVDEC CFRSCDLRRL EMYCAPLKPAKSA Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Description:IGF-1 LR3 (Long Arg3 Insulin-like Growth Factor-1) is a synthetic analog of human IGF-1, specifically modified by substituting arginine at position 3 and adding a 13-amino…

Chemical Information: Molecular Formula: C₃₈H₄₉N₉O₅ Molecular Weight: 711.86 g/mol Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂ Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC Verified)…

Chemical Information: Molecular Formula: C63H83N17O14 Molecular Weight: 1302.46 Da Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 (YNWNSFGLRF-NH2) Molecular Structure: Refer to Certificate of Analysis for detailed structural information. Storage and Handling: Store sealed at recommended laboratory freezer temperatures. Protect from light, moisture, and excessive heat. Handle using standard laboratory safety procedures to maintain product integrity. Product Specifications: Purity: ≥99% (HPLC…